Transcript | Ll_transcript_14804 |
---|---|
CDS coordinates | 1332-2027 (+) |
Peptide sequence | MMEKLGDDGLIVDGRKLFFEYSSKPTGGPGQDGAIKSGHNHKSITLPSDWICTICGYINFARRTSCYQCNDPRTEDAPAADISSSNSTALGKKGLEAGPTHVLVVRGLDENADEGMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFHSVEDATKALAATNGTTLERNGQILRVAYAKSIVGPGSGASQSSSLAAAAIEAATFSQQVIFFLLSPVLSVDYALFTPDFHI* |
ORF Type | complete |
Blastp | SUPPRESSOR OF ABI3-5 from Arabidopsis with 68.06% of identity |
---|---|
Blastx | SUPPRESSOR OF ABI3-5 from Arabidopsis with 68.88% of identity |
Eggnog | RNA binding motif protein(ENOG410YNFQ) |
Kegg | Link to kegg annotations (AT3G54230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423246.1) |
Pfam | Zn-finger in Ran binding protein and others (PF00641.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer