Transcript | Ll_transcript_14814 |
---|---|
CDS coordinates | 567-944 (+) |
Peptide sequence | MLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFHSVDDATKALEATNGTTLEKNGQILRVAYAKSILGPGSGTSQSSSLAAAAIEAATFAQQYDTVGWAPKEYNPDDKQFAGPEQTGTEVGAPQS |
ORF Type | 3prime_partial |
Blastp | SUPPRESSOR OF ABI3-5 from Arabidopsis with 76.86% of identity |
---|---|
Blastx | SUPPRESSOR OF ABI3-5 from Arabidopsis with 63.78% of identity |
Eggnog | RNA binding motif protein(ENOG410YNFQ) |
Kegg | Link to kegg annotations (AT3G54230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446987.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer