Protein coding transcript 262278

• Transcript: Ll_transcript_14814
• CDS coordinates: 567-944 (+)
• Peptide sequence: MLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFHSVDDATKALEATNGTTLEKNGQILRVAYAKSILGPGSGTSQSSSLAAAAIEAATFAQQYDTVGWAPKEYNPDDKQFAGPEQTGTEVGAPQS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_14814

• Blastp: SUPPRESSOR OF ABI3-5 from Arabidopsis with 76.86% of identity
• Blastx: SUPPRESSOR OF ABI3-5 from Arabidopsis with 63.78% of identity
• Eggnog: RNA binding motif protein(ENOG410YNFQ)
• Kegg: Link to kegg annotations (AT3G54230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446987.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;