Transcript | Ll_transcript_520639 |
---|---|
CDS coordinates | 243-662 (+) |
Peptide sequence | MSLFRRMAWSVKSSIDDSSFSSPTSNRASNGRTRMIRVIQEFQTNIGSKLQEVKKNLPAKVLFLLVGFYCATAFATVIGQTGDWDILSAGLAVVIVEGIGALMYRASLPFVSKSKSLISLFNYWKVGLKLGLFLDSFKY* |
ORF Type | complete |
Blastp | Ycf20-like protein from Arabidopsis with 41.43% of identity |
---|---|
Blastx | Ycf20-like protein from Arabidopsis with 45.22% of identity |
Eggnog | Protein of unknown function (DUF565)(ENOG4111W7G) |
Kegg | Link to kegg annotations (AT1G65420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435964.1) |
Pfam | Protein of unknown function (DUF565) (PF04483.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer