Protein coding transcript 26228

• Transcript: Ll_transcript_520639
• CDS coordinates: 243-662 (+)
• Peptide sequence: MSLFRRMAWSVKSSIDDSSFSSPTSNRASNGRTRMIRVIQEFQTNIGSKLQEVKKNLPAKVLFLLVGFYCATAFATVIGQTGDWDILSAGLAVVIVEGIGALMYRASLPFVSKSKSLISLFNYWKVGLKLGLFLDSFKY*
• ORF Type: complete

Annotations of Ll_transcript_520639

• Blastp: Ycf20-like protein from Arabidopsis with 41.43% of identity
• Blastx: Ycf20-like protein from Arabidopsis with 45.22% of identity
• Eggnog: Protein of unknown function (DUF565)(ENOG4111W7G)
• Kegg: Link to kegg annotations (AT1G65420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435964.1)
• Pfam: Protein of unknown function (DUF565) (PF04483.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;