Protein coding transcript 262364

• Transcript: Ll_transcript_13899
• CDS coordinates: 3-497 (+)
• Peptide sequence: YGSLFFVGVNNCQTVQPVVAIERTVFYRERAAGMYSALPYAIAQVIIEIPYCFVQTMLFSFIVYAMVSFEWQVAKVFWFIFVSFFTFLYFTYYGMMTVSITPNHQVASIFGAAFYGLFNLFSGFFIARPKIPKWWVWYYWICPIAWTVYGLIVSQYRDVMDLIEV
• ORF Type: internal

Annotations of Ll_transcript_13899

• Blastp: ABC transporter G family member 36 from Arabidopsis with 74.55% of identity
• Blastx: ABC transporter G family member 42 from Oryza sativa with 73.33% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT1G59870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429223.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;