Transcript | Ll_transcript_13899 |
---|---|
CDS coordinates | 3-497 (+) |
Peptide sequence | YGSLFFVGVNNCQTVQPVVAIERTVFYRERAAGMYSALPYAIAQVIIEIPYCFVQTMLFSFIVYAMVSFEWQVAKVFWFIFVSFFTFLYFTYYGMMTVSITPNHQVASIFGAAFYGLFNLFSGFFIARPKIPKWWVWYYWICPIAWTVYGLIVSQYRDVMDLIEV |
ORF Type | internal |
Blastp | ABC transporter G family member 36 from Arabidopsis with 74.55% of identity |
---|---|
Blastx | ABC transporter G family member 42 from Oryza sativa with 73.33% of identity |
Eggnog | (ABC) transporter(COG0842) |
Kegg | Link to kegg annotations (AT1G59870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429223.1) |
Pfam | ABC-2 type transporter (PF01061.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer