Protein coding transcript 262389

• Transcript: Ll_transcript_15875
• CDS coordinates: 1-297 (+)
• Peptide sequence: TSYPTSNLYFIQVWKIQCVLLDTLRDEDEVLRSMTNKMVKKFEKYWDDYSIVLAMGAILDPRVKLETLNYCFERVDDSTFETKLQLVKRKLYMLFEQYR
• ORF Type: internal

Annotations of Ll_transcript_15875

• Blastp: Zinc finger BED domain-containing protein RICESLEEPER 3 from Oryza sativa with 30.53% of identity
• Blastx: Zinc finger BED domain-containing protein RICESLEEPER 3 from Oryza sativa with 30.53% of identity
• Eggnog: transposon protein(ENOG410Y37V)
• Kegg: Link to kegg annotations (4339741)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414580.1)
• Pfam: Domain of unknown function (DUF4413) (PF14372.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;