Protein coding transcript 262390

• Transcript: Ll_transcript_15878
• CDS coordinates: 462-851 (+)
• Peptide sequence: MSPPRTGSELSKKILEFLNEWGIDKNIFSLTLDNVSSNDVMQEQLKNKLIVENSLLCDGQLFLVRCSAHILNILVQEGLKVASDNLYKIRDSIKCVRGSEGRMLKLMVCIEKIGGVDASIDLCLDVPTG*
• ORF Type: complete

Annotations of Ll_transcript_15878

• Blastp: Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 36.43% of identity
• Blastx: Zinc finger BED domain-containing protein RICESLEEPER 3 from Oryza sativa with 30.31% of identity
• Eggnog: transposon protein(ENOG410Y37V)
• Kegg: Link to kegg annotations (4334009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;