Protein coding transcript 262391

• Transcript: Ll_transcript_15880
• CDS coordinates: 3-365 (+)
• Peptide sequence: AIIEHDLPFKFAEFKKMICLINYLNLDSILVSRNTTKVDVMRIYMIEKDKLKKEMTSIPNRISLTSDLWTTCTTEGYICLTAHYVDSNWKLASKVISFCHMPPPRTRSELSKKILEFLNE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_15880

• Blastp: Putative AC9 transposase from Zea with 32.14% of identity
• Blastx: Putative AC9 transposase from Zea with 30.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;