Protein coding transcript 262397

• Transcript: Ll_transcript_15470
• CDS coordinates: 1-378 (+)
• Peptide sequence: SVVVLLCREPCLSVNALKDMNWDLSQWCPLIDDRCFLQWLVKVPSEQEQLRARQISAQQINKVEELWKTNPDASFEDLEKPGVDDEPQSVALKYEDAYQYQNVFAPLIKLEADYDKMMKESQSKDN
• ORF Type: internal

Annotations of Ll_transcript_15470

• Blastp: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.06% of identity
• Blastx: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.06% of identity
• Eggnog: Helicase(COG1112)
• Kegg: Link to kegg annotations (AT5G47010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421384.1)
• Pfam: RNA helicase (UPF2 interacting domain) (PF09416.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;