Protein coding transcript 262398

• Transcript: Ll_transcript_15472
• CDS coordinates: 2-781 (+)
• Peptide sequence: ILECYNWGCRNVFLLGFISAKTESVVVLLCREPCLNVNALKDMNWDLSQWCPLIDDRCFLQWLVKVPSEQEQLRARHISAQQINKVEELWKTNPDASFEDLEKPGVDDEPQSVALKYEDAYQYQNVFAPLIKLEADYDKMMKESQSKDNVTVRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDVNHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_15472

• Blastp: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.66% of identity
• Blastx: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.55% of identity
• Eggnog: Helicase(COG1112)
• Kegg: Link to kegg annotations (AT5G47010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445009.1)
• Pfam: RNA helicase (UPF2 interacting domain) (PF09416.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;