Protein coding transcript 262404

• Transcript: Ll_transcript_15464
• CDS coordinates: 2-595 (+)
• Peptide sequence: ILECYNWGCRNVFLLGFISAKTESVVVLLCREPCLNVNALKDMNWDLSQWCPLIDDRCFLQWLVKVPSEQEQLRARQISAQQINKVEELWKTNPDASFEDLEKPGVDDEPQSVALKYEDAYQYQNVFAPLIKLEADYDKMMKESQSKDNVTVRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAGHPAWQS
• ORF Type: internal

Annotations of Ll_transcript_15464

• Blastp: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.42% of identity
• Blastx: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 92.42% of identity
• Eggnog: Helicase(COG1112)
• Kegg: Link to kegg annotations (AT5G47010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423136.1)
• Pfam: RNA helicase (UPF2 interacting domain) (PF09416.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;