Protein coding transcript 262409

• Transcript: Ll_transcript_15471
• CDS coordinates: 200-634 (+)
• Peptide sequence: MDSQQSNLFDTASQPDAANDAYTFLEFNTQGDDFDYPEFHDPIRSPVSWPTPSDSLAEPSERGGGGNGAGSDHQSDASPVSATPGSATKGRSGSSAGGNSQMVDALVPGMSELNFEDTGDDDNFEYGKGDFTEHACKYCGVSNPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15471

• Blastp: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 58.06% of identity
• Blastx: Regulator of nonsense transcripts 1 homolog from Arabidopsis with 56.86% of identity
• Eggnog: Helicase(COG1112)
• Kegg: Link to kegg annotations (AT5G47010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445008.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;