Transcript | Ll_transcript_13401 |
---|---|
CDS coordinates | 3-395 (+) |
Peptide sequence | HIGIKGRKDPQASALTPAGLIQKPSVHVTGISMPKPYHQSPASLQFGGPNQQIQPQGMSTTSLHMPIHMPLPFGNPAQLQHVYVPGLQSHPMHHQGIMHQGQNMNFTHPMGHQLSHQLGNTGIGISPQYPQ |
ORF Type | internal |
Blastp | Eukaryotic translation initiation factor 4G from Arabidopsis with 47.27% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 4G from Arabidopsis with 47.27% of identity |
Eggnog | Eukaryotic translation initiation factor 4 gamma(ENOG410ZIZB) |
Kegg | Link to kegg annotations (AT3G60240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463465.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer