Protein coding transcript 262478

• Transcript: Ll_transcript_13407
• CDS coordinates: 1-384 (+)
• Peptide sequence: KGRKEPQVSASIPAGLIQKPSVVSVTGPSIAMPYHHSQASLQFGGPNQQIQPQGMSTTSLHMPIHMPLPFGNPAQLQHVYVPGLQSHPMHHQGIMHQGQNMNFTHPMGHQLSHQLGNTGIGISPQYPQ
• ORF Type: internal

Annotations of Ll_transcript_13407

• Blastp: Eukaryotic translation initiation factor 4G from Arabidopsis with 44.54% of identity
• Blastx: Eukaryotic translation initiation factor 4G from Arabidopsis with 44.54% of identity
• Eggnog: Eukaryotic translation initiation factor 4 gamma(ENOG410ZIZB)
• Kegg: Link to kegg annotations (AT3G60240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449800.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;