Protein coding transcript 262487

• Transcript: Ll_transcript_15062
• CDS coordinates: 320-667 (+)
• Peptide sequence: MAASTTSQVYIQVIEDVVNKVRDEFVNNGGPGDEVLKEFQAMWESKMIQAGVILGPIVRSSAPKPTPGGPITPVHDLNMPYEATEEYETPTAEILFPPVSFYFLASKQKMYEVMN*
• ORF Type: complete

Annotations of Ll_transcript_15062

• Blastp: Transcription initiation factor IIA subunit 1 from Homo with 40.38% of identity
• Blastx: -
• Eggnog: transcription factor IIA(ENOG4111M8K)
• Kegg: Link to kegg annotations (2957)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454088.1)
• Pfam: Transcription factor IIA, alpha/beta subunit (PF03153.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;