| Transcript | Ll_transcript_14549 |
|---|---|
| CDS coordinates | 1-309 (+) |
| Peptide sequence | HKTRLYVCRGKHVVHVKEVPFARSSLSHDDIFILDTESKIFQFNGSNSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRLMSDSETGEFWGFFGGFAPLPR |
| ORF Type | internal |
| Blastp | Villin-5 from Arabidopsis with 83.5% of identity |
|---|---|
| Blastx | Villin-4 from Arabidopsis with 86.41% of identity |
| Eggnog | capping protein (actin filament) gelsolin-like(ENOG410XR0A) |
| Kegg | Link to kegg annotations (AT5G57320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462577.1) |
| Pfam | Gelsolin repeat (PF00626.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer