Protein coding transcript 262591

• Transcript: Ll_transcript_13720
• CDS coordinates: 3-347 (+)
• Peptide sequence: LPLPPLVVTNSSPFSHSNSAATSPSVPRSPARADNPMSPGSRWKKGKLLGRGTFGHVYLGFNNDCGEMCAMKEVTLFSDDAKSKECAKQLNQEINLLSRLRHPNIVQYYGSETVD
• ORF Type: internal

Annotations of Ll_transcript_13720

• Blastp: Mitogen-activated protein kinase kinase kinase YODA from Arabidopsis with 76.52% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase YODA from Arabidopsis with 76.52% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT1G63700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442112.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;