Protein coding transcript 262594

• Transcript: Ll_transcript_13733
• CDS coordinates: 377-946 (+)
• Peptide sequence: MPSWWGKLSSNSKETKKKANKESFIDTLHRKFKIPSEVKLSSKTGGSRTRRHSNETISEKADNSPADSRSPSPSKVGRCQSFAERPHAQPLPLPGLHPSSLGRVDSEISISSKSRLEKGSKPSLFLPLPKPACMRGRPKPSDFDGDLVTASVSSDCSVDSDEPAESRNRSPRATDSETGIRTAVGCPSR*
• ORF Type: complete

Annotations of Ll_transcript_13733

• Blastp: Mitogen-activated protein kinase kinase kinase YODA from Arabidopsis with 44.74% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase YODA from Arabidopsis with 50% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT1G63700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442112.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;