Transcript | Ll_transcript_13966 |
---|---|
CDS coordinates | 2-487 (+) |
Peptide sequence | VVRPFRTQHIIPSQGYVIYSIGKNLKKEYTHLNEKQVEELSESGEEITDTILSPEVAFTGDTTSNFYHDPLNADALKAKVLITEATFLDDSFGIDHAQQYGHTHIFEIMEKANQISNKAVLLTHFSSRYNIEDIRQAASKLQSRLSAKVVPLTEGFKSKHS* |
ORF Type | 5prime_partial |
Blastp | tRNase Z TRZ2, chloroplastic from Arabidopsis with 68.32% of identity |
---|---|
Blastx | tRNase Z TRZ2, chloroplastic from Arabidopsis with 68.32% of identity |
Eggnog | Zinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA (By similarity)(COG1234) |
Kegg | Link to kegg annotations (AT2G04530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459100.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer