Transcript | Ll_transcript_15958 |
---|---|
CDS coordinates | 1-372 (+) |
Peptide sequence | HGNVQVAKIETEKMLIQMAETELEKRKQEGKYNGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGLISSVANLSAPVEEWSVGGTALTSLMDVERRHGKFKPVITKAMVELE |
ORF Type | internal |
Blastp | Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 from Arabidopsis with 89.52% of identity |
---|---|
Blastx | Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 from Arabidopsis with 89.52% of identity |
Eggnog | phosphohexokinase(COG0205) |
Kegg | Link to kegg annotations (AT1G12000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439848.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer