Protein coding transcript 262669

• Transcript: Ll_transcript_15958
• CDS coordinates: 1-372 (+)
• Peptide sequence: HGNVQVAKIETEKMLIQMAETELEKRKQEGKYNGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGLISSVANLSAPVEEWSVGGTALTSLMDVERRHGKFKPVITKAMVELE
• ORF Type: internal

Annotations of Ll_transcript_15958

• Blastp: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 from Arabidopsis with 89.52% of identity
• Blastx: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 from Arabidopsis with 89.52% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT1G12000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439848.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;