Protein coding transcript 262703

• Transcript: Ll_transcript_14971
• CDS coordinates: 296-1207 (+)
• Peptide sequence: MNIKTQMGNINIFWPHLVFVFCFVMFLLLTPSLCQDDSDDDDSGDDAAVYIVTLRQPHASHFQDELTRVGKGFKHVGTVSGRTTLHKPRPRNVTHTVKRQGSYIVHFHDLLLKKVFKGEKYLKLYSYHYLINGFAVFVTQQQADKLSSRKEVSNVVLDYSVRTATTHTPQFLDLPKGAWFQAGGFENAGEGITIGFVDTGIDPTHPSFADYKSQPPAQFSGICEVTKDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASPFDGDGHGTHTASIAAGNHGVPVVVAGHNFGNASGMAPRSQ*
• ORF Type: complete

Annotations of Ll_transcript_14971

• Blastp: Subtilisin-like protease SBT2.2 from Arabidopsis with 61.62% of identity
• Blastx: Subtilisin-like protease SBT2.3 from Arabidopsis with 64.02% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT4G20430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459994.1)
• Pfam: Peptidase inhibitor I9 (PF05922.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;