| Transcript | Ll_transcript_14107 |
|---|---|
| CDS coordinates | 1-315 (+) |
| Peptide sequence | GNFQMEDVIAEFPTVFQEPQGLPPRRPQDHAIILREGAVIPNIRPYRCPYYQKNEIEKLVKEMLQAGIIKPNTSPYSSPVILVKKKDGGWRFCVDYRALNKFIVP |
| ORF Type | internal |
| Blastp | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 46.51% of identity |
|---|---|
| Blastx | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 46.51% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YIL082W-A) |
| CantataDB | Link to cantataDB annotations (CNT0002695) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020232518.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer