Protein coding transcript 262849

• Transcript: Ll_transcript_16222
• CDS coordinates: 2-406 (+)
• Peptide sequence: EGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVGYSWIDGLKDHAAKHVTDKMMLNAPHIFPHNTPNTKEGYYYRMIFERFFPQNSAGLTVPGGPSVACSTAKAVEWDAAWSNNLDPSGRAALGVHVSAY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16222

• Blastp: Asparagine synthetase, nodule [glutamine-hydrolyzing] from Pisum with 89.55% of identity
• Blastx: Asparagine synthetase, nodule [glutamine-hydrolyzing] from Pisum with 81.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000283)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016162712.1)
• Pfam: Asparagine synthase (PF00733.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;