Protein coding transcript 262851

• Transcript: Ll_transcript_13798
• CDS coordinates: 2-664 (+)
• Peptide sequence: DLLGVDLSLPSQQSGAGQTSNSAADVLLDLLSIGSPSAPSSSSTVDILSSNASNGAPVSPLNDLSSLSLSSRATSNVGGAPMMDLLDDFSPSPSAENNGPVHPPITAFENSHLRLTFDFSKQPGSPQTTIIQATFMNLSSDTYTDFVFQAAVPKFLQLHLDPASSNTLPASGNGSIVQNLKVTNSQHGKKSLVMRIRIAYKINGKDTLEEGQINNFPRGL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_13798

• Blastp: AP-1 complex subunit gamma-1 from Arabidopsis with 61.71% of identity
• Blastx: AP-1 complex subunit gamma-1 from Arabidopsis with 61.71% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPKK)
• Kegg: Link to kegg annotations (AT1G23900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423770.1)
• Pfam: Adaptin C-terminal domain (PF02883.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;