Protein coding transcript 262942

• Transcript: Ll_transcript_14189
• CDS coordinates: 1-510 (+)
• Peptide sequence: VEDVMGQKVATLVGKWDDSLYYVNGDVNLKPKDFTSLDASLLWKRTMPPTNLTRYNLTSFAITLNELTPGLKEKLPPTDSRLRPDQRHLENGEYEKANIEKQRLEKRQRMSRKMQENGWKPRWFYQGGENGTFGYIGGYWEARAQGKWNECPNIFGEFNEDIVDPLDAS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_14189

• Blastp: Oxysterol-binding protein-related protein 2A from Arabidopsis with 72.12% of identity
• Blastx: Oxysterol-binding protein-related protein 2A from Arabidopsis with 72.12% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XP9E)
• Kegg: Link to kegg annotations (AT4G22540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446698.1)
• Pfam: Oxysterol-binding protein (PF01237.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;