Protein coding transcript 262952

• Transcript: Ll_transcript_14216
• CDS coordinates: 163-717 (+)
• Peptide sequence: MGSHNRTELEFFNHIGLGSNNVGGFINGQWKATGSSITSTNPSNNKIIAEVTEATLQDYEEGLKASSEAAKIWMSVPAPKRGEIVRQIGEALRAKLDPLGRLVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPDHMMFEVWNPLGIVGVITAFNFPCAVLGMIFINLSRCSQ*
• ORF Type: complete

Annotations of Ll_transcript_14216

• Blastp: Aldehyde dehydrogenase family 7 member A1 from Pisum with 80.92% of identity
• Blastx: Aldehyde dehydrogenase family 7 member A1 from Malus with 86.6% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415372.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;