Protein coding transcript 262992

• Transcript: Ll_transcript_14858
• CDS coordinates: 1220-1636 (+)
• Peptide sequence: MPKASSDAKASDNLLKRKGAGTGRKQKKKAAKDPNKPKRPPSAFFVFMAEFREQFKKENPNNKSVAAVGKACGSKWKAMTDADKAPYIAKAEKKKEEYEKTLRAYTNGLATGKDGEESDKSKSEVNDDDQDDEEEDDE*
• ORF Type: complete

Annotations of Ll_transcript_14858

• Blastp: High mobility group B protein 4 from Arabidopsis with 57.04% of identity
• Blastx: HMG1/2-like protein from Vicia with 71.26% of identity
• Eggnog: high mobility group(COG5648)
• Kegg: Link to kegg annotations (AT2G17560)
• CantataDB: Link to cantataDB annotations (CNT0002562)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445178.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;