Protein coding transcript 262993

• Transcript: Ll_transcript_14861
• CDS coordinates: 325-678 (+)
• Peptide sequence: MPKATSDAKPADSRLKRKGAGAGRKQTKKAAKDPNKPKRPPSAFFVFMAEFREQFKKENPNNKSVAAVGKACGSKWKAMTDADKAPYIAKAEKKKEEYEKTLRAYTNGLVVVFPYFS*
• ORF Type: complete

Annotations of Ll_transcript_14861

• Blastp: HMG1/2-like protein from Ipomoea with 64.58% of identity
• Blastx: HMG1/2-like protein from Vicia with 59.29% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (109177607)
• CantataDB: Link to cantataDB annotations (CNT0002562)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423917.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;