Protein coding transcript 262995

• Transcript: Ll_transcript_14864
• CDS coordinates: 325-741 (+)
• Peptide sequence: MPKATSDAKPADSRLKRKGAGAGRKQTKKAAKDPNKPKRPPSAFFVFMAEFREQFKKENPNNKSVAAVGKACGSKWKAMTDADKAPYIAKAEKKKEEYEKTLRAYTNGLATGKDGEESDKSKSEVNDDDQDDEEEDDE*
• ORF Type: complete

Annotations of Ll_transcript_14864

• Blastp: High mobility group B protein 4 from Arabidopsis with 57.78% of identity
• Blastx: HMG1/2-like protein from Vicia with 61.83% of identity
• Eggnog: high mobility group(COG5648)
• Kegg: Link to kegg annotations (AT2G17560)
• CantataDB: Link to cantataDB annotations (CNT0002562)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445178.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;