Transcript | Ll_transcript_14865 |
---|---|
CDS coordinates | 1329-1739 (+) |
Peptide sequence | MPKASSDAKASDNLLKRKGAGTGRKQKKKAAKDPNKPKRPPSAFFVFMAEFREQFKKENPNNKSVAAVGKACGSKWKAMTDADKAPYIAKAEKKKEEYEKTLRAYTNGLATGKDGEESDKSKSEVNDDDQDDEVDF* |
ORF Type | complete |
Blastp | High mobility group B protein 2 from Arabidopsis with 69.09% of identity |
---|---|
Blastx | HMG1/2-like protein from Vicia with 70.24% of identity |
Eggnog | high mobility group(COG5648) |
Kegg | Link to kegg annotations (AT1G20693) |
CantataDB | Link to cantataDB annotations (CNT0002562) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445178.1) |
Pfam | HMG-box domain (PF09011.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer