Transcript | Ll_transcript_16250 |
---|---|
CDS coordinates | 3-1046 (+) |
Peptide sequence | LRPGYTFNIEAGKQALRNINSLALFSNIEVNPRPDEKNEGGIIVEIKLKELDQKTAEVSTEWSIVPGRGGRPTLASIQPGGTVTFEHRNLYGLNRSVNGSITTSNFLNPQDDLAFKLEYVHPYLDGVTDRSNRTLRVSCFNNRKLSPVFTGGPGLDEVPPIWVDRAGVKANITENFTRQSKFTYGLVMEEITTRDESSHICTNGQRILPSGGISADGPPTTLSGTGIDRVAFLQANITRDNTRFVNGAVVGERNVFQVDQGLGIGSQFPFFNRHQLTLTRFLQLARVEEGAGKSPPPVLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILEVGMIG* |
ORF Type | 5prime_partial |
Blastp | Protein TOC75, chloroplastic from Pisum with 88.08% of identity |
---|---|
Blastx | Protein TOC75, chloroplastic from Pisum with 88.08% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458364.1) |
Pfam | Surface antigen (PF01103.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer