Protein coding transcript 263067

• Transcript: Ll_transcript_16274
• CDS coordinates: 653-1240 (+)
• Peptide sequence: MEEITTRDESSNICTNGQRILPSGGISTDGPPTTLSGTGIDRMAFLQANITRDNTHFVNGAVVGERNVFQVDQGLGIGSQFPFFNRHQLTLTRFLQLMKVEEGAGKSPPPVLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAELRIPIKGTHVYGFAEHGNDLGSSKSLKGNPTEVYRRL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16274

• Blastp: Protein TOC75, chloroplastic from Pisum with 87.24% of identity
• Blastx: Protein TOC75, chloroplastic from Pisum with 86.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436590.1)
• Pfam: Surface antigen (PF01103.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;