Protein coding transcript 263073

• Transcript: Ll_transcript_16261
• CDS coordinates: 3-350 (+)
• Peptide sequence: LRPGYTFNIEAGKQALRNINSLALFSNIEVNPRPDEKNEGGIIVEIKLKELDQKTAEVSTEWSIVPGRGGRPTLASIQPGGTVTFEHRNLYGLNRSVNGSITTSNFLNPQVLFLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16261

• Blastp: Protein TOC75, chloroplastic from Pisum with 89.09% of identity
• Blastx: Protein TOC75, chloroplastic from Pisum with 89.09% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458364.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;