Protein coding transcript 263075

• Transcript: Ll_transcript_16265
• CDS coordinates: 3-623 (+)
• Peptide sequence: LRPGYTFNIEAGKQALRNINSLALFSNIEVNPRPDEKNEGGIIVEIKLKELDQKTAEVSTEWSIVPGRGGRPTLASIQPGGTITFEHRNLHGLNRSVNGSVTTSNFLNPQDDLAFKLEYVHPYLDGVTVPSNRTLRVSCFNNRKLSPVFTGGPGLDEVPPIWVDRAGVKANITENFTRQSKFTYGLVMEEITTRDESSNICTNGQRI
• ORF Type: internal

Annotations of Ll_transcript_16265

• Blastp: Protein TOC75, chloroplastic from Pisum with 88.41% of identity
• Blastx: Protein TOC75, chloroplastic from Pisum with 88.41% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436590.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;