Protein coding transcript 263095

• Transcript: Ll_transcript_16411
• CDS coordinates: 150-548 (+)
• Peptide sequence: MFLRTLLRQPTTNEGFSLYQKLDAEKSLTQLAMSFTSRSIFRSLMAAMEELELNAHNANIKSEHAHMYLYIIREQQIDDLVPYTKRIDIDAAQEEITVKAILEGLAREVHTSVGVRMHRLGVVVWEIKLWMAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16411

• Blastp: Acetyl-CoA carboxylase 1 from Arabidopsis with 60.9% of identity
• Blastx: Acetyl-CoA carboxylase 1 from Arabidopsis with 64.07% of identity
• Eggnog: acetyl-CoA carboxylase biotin carboxylase(COG0439)
• Kegg: Link to kegg annotations (AT1G36160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414857.1)
• Pfam: Acetyl-CoA carboxylase, central region (PF08326.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;