Protein coding transcript 263119

• Transcript: Ll_transcript_13527
• CDS coordinates: 1-888 (+)
• Peptide sequence: VIKVENEGKSWLWSRWSQHLITTNIPGHARKIIRSMLDRMRIDQFVWTPYSNMHFMGQTSDMARARVPLICFALVEWHAADRVMHQFGLQQPIPADPINLEKQHKMDLRGKNDYNWPEKHNEWIQIWNNRNDYIVIGMPANQPLYHYSDYMQWYLPRTRKFISPDGAYSIGSYNFIKTIHDQCASSNEFPSPLDTIHDIFLNCDNMMDAYCQLLPDAFSNTNNEAPHLNNFICLLHRRFLNHRAKHKQILIPNHTLKLNILNNNHHLGLRLLEEWVTTHSPIYLHHLKCHCSVPHH
• ORF Type: internal

Annotations of Ll_transcript_13527

• Blastp: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 35.85% of identity
• Blastx: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 35.85% of identity
• Eggnog: Serine threonine-protein phosphatase 7 long form homolog(ENOG410YHBV)
• Kegg: Link to kegg annotations (AT1G48120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442354.1)
• Pfam: Plant mobile domain (PF10536.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;