Transcript | Ll_transcript_13538 |
---|---|
CDS coordinates | 248-748 (+) |
Peptide sequence | MRIDQMDLRGKNDYNWPEKHNEWIQIWNNRNDYIVIGMPANQPLYHYSDYMQWYLPRTRKFISPDGAYSIGSYNFIKTIRDQCAPSNEFPSPLDTIRDIFLNCDNIMNACCQLLPDAFSNTNNEAPHLNNFICLLHRRFLNLRAKHKRILISNHTLKLDILNNNHHL |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 38.98% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 38.98% of identity |
Eggnog | Serine threonine-protein phosphatase 7 long form homolog(ENOG410YHBV) |
Kegg | Link to kegg annotations (AT1G48120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442354.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer