Protein coding transcript 263135

• Transcript: Ll_transcript_16334
• CDS coordinates: 284-892 (+)
• Peptide sequence: MHAYVDSFNFQGMEFDEAIRAFLQGFRLPGEAQKIDRIMEKFAERYCKCNPEAFSSADTAYVLAYSVIMLNTDAHNPMVKIKMSADDFIRNNRGIDDGKDLPDEYLRSLFERISRNEIKMKENDIPPQQRQSVNPNRLLGLDSILNIVIRKRGEDMETSDDLIRHMQEQFKEKARKSESVYYAAMDVVILRFMIEVCWAPMLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16334

• Blastp: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 83.9% of identity
• Blastx: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 85.66% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT1G01960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463522.1)
• Pfam: Sec7 domain (PF01369.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;