Transcript | Ll_transcript_16336 |
---|---|
CDS coordinates | 3-362 (+) |
Peptide sequence | DVVILRFMIEVCWAPMLAAFSVPLDQSDDEVVISLCLEGFRYAIHVTSVMSMKTHRDVYVTSLAKFTSLHSPADIKQKNIDAIKAIVTIADEDGNYLQEAWEHILTCVSRFEHLHLLGEG |
ORF Type | internal |
Blastp | Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 85.83% of identity |
---|---|
Blastx | Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 85.83% of identity |
Eggnog | and Sec7 domain(COG5307) |
Kegg | Link to kegg annotations (AT1G01960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463522.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer