Protein coding transcript 263141

• Transcript: Ll_transcript_16342
• CDS coordinates: 91-744 (+)
• Peptide sequence: MKTQRDAFVTSLAKFTSLHSPVDIKQKNVDAIKAIITIADEDGNYLQEAWEHILTCVSRFEHLLLLGEGAPPDATFFAFPHNDSEKAKQAKPTILPVLKKGPGRMHYAASTVMRGSYDSAGIGSNASGAVTSEQVNNLVSNLNMLEQVGSSEMNRIFTRSQKLNSEAIIDFVKALCKVSMEELRSPSDPRVFSLTKIVEITYVLYSYLMHAVSFLSL*
• ORF Type: complete

Annotations of Ll_transcript_16342

• Blastp: Brefeldin A-inhibited guanine nucleotide-exchange protein 2 from Arabidopsis with 74.38% of identity
• Blastx: Brefeldin A-inhibited guanine nucleotide-exchange protein 2 from Arabidopsis with 73.82% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT3G60860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460855.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;