Transcript | Ll_transcript_16346 |
---|---|
CDS coordinates | 1-663 (+) |
Peptide sequence | PTINGNGEEQVEGSDSHSEITNDASDVSNIEQRRAYKLELQEGISLFNRKPKKGIEFLINANKVGDSPEDIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVDSFNFQGMEFDEAIRAFLQGFRLPGEAQKIDRIMEKFAERYCKCNPKAFSSADTAYVLAYSVIMLNTDAHNPMVKNKMSADDFIRNNRGIDDGKDLPDEYLKSLFERISRNEIKMK |
ORF Type | internal |
Blastp | Brefeldin A-inhibited guanine nucleotide-exchange protein 2 from Arabidopsis with 83.03% of identity |
---|---|
Blastx | Brefeldin A-inhibited guanine nucleotide-exchange protein 2 from Arabidopsis with 83.03% of identity |
Eggnog | and Sec7 domain(COG5307) |
Kegg | Link to kegg annotations (AT3G60860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447286.1) |
Pfam | Sec7 domain (PF01369.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer