Protein coding transcript 263148

• Transcript: Ll_transcript_16325
• CDS coordinates: 3-314 (+)
• Peptide sequence: DVVILRFMIEVCWAPMLAAFSVPLDQSDDEVVISLCLEGFRYAIHVTSVMSMKTHRDVYVTSLAKFTSLHSPADIKQKNIDAIKVGEINISSSWLMNICLRIF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16325

• Blastp: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 84.71% of identity
• Blastx: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 85.71% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT1G01960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447286.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;