Protein coding transcript 263250

• Transcript: Ll_transcript_113449
• CDS coordinates: 1-441 (+)
• Peptide sequence: AVLTDTFHKPGFKLHVLVLQHLFCLAETGAITQPLWDVATNPYPYPNNAAFVHEFTVKLLSTSFPNMTAAEVTQFVNGLFQSTNDLSAFKTHIRDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPSELQDEMADS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_113449

• Blastp: Protein EXPORTIN 1A from Arabidopsis with 83.56% of identity
• Blastx: Protein EXPORTIN 1A from Arabidopsis with 83.56% of identity
• Eggnog: exportin(COG5101)
• Kegg: Link to kegg annotations (AT5G17020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423472.1)
• Pfam: CRM1 C terminal (PF08767.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;