Transcript | Ll_transcript_113449 |
---|---|
CDS coordinates | 1-441 (+) |
Peptide sequence | AVLTDTFHKPGFKLHVLVLQHLFCLAETGAITQPLWDVATNPYPYPNNAAFVHEFTVKLLSTSFPNMTAAEVTQFVNGLFQSTNDLSAFKTHIRDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPSELQDEMADS* |
ORF Type | 5prime_partial |
Blastp | Protein EXPORTIN 1A from Arabidopsis with 83.56% of identity |
---|---|
Blastx | Protein EXPORTIN 1A from Arabidopsis with 83.56% of identity |
Eggnog | exportin(COG5101) |
Kegg | Link to kegg annotations (AT5G17020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423472.1) |
Pfam | CRM1 C terminal (PF08767.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer