Protein coding transcript 263273

• Transcript: Ll_transcript_114634
• CDS coordinates: 456-866 (+)
• Peptide sequence: MALDEVSTKSKGKYQVFLSFRGKDTRLNFTDHLYEALKKKGIIIFRDEEELERGESISQNLLDAIEESLIAIVVISKNYASSTWCLDELQKIVDCKQSLGLQVFPIFYGVDPSHVGHQSESFEQAFKDHEQKFVGDK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_114634

• Blastp: TMV resistance protein N from Nicotiana with 57.14% of identity
• Blastx: TMV resistance protein N from Nicotiana with 57.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451366.1)
• Pfam: TIR domain (PF01582.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;