Transcript | Ll_transcript_114636 |
---|---|
CDS coordinates | 382-867 (+) |
Peptide sequence | MALDEVSTKSKGKYQVFLSFRGKDTRLNFTDHLYEALKKKGIIIFRDEEELERGESISQNLLDAIEESLIAIVVISKNYASSTWCLDELQKIVECKQSLGLHVFPIFYGVDPSHVGHQSESFEQAFKVHEQKFDEDKEKVQKWRDVLKDVAKLSGWDSKNK* |
ORF Type | complete |
Blastp | TMV resistance protein N from Nicotiana with 57.04% of identity |
---|---|
Blastx | TMV resistance protein N from Nicotiana with 57.04% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451366.1) |
Pfam | TIR domain (PF01582.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer