| Transcript | Ll_transcript_113784 |
|---|---|
| CDS coordinates | 23-388 (+) |
| Peptide sequence | MVLAAKLVTGTLNWLAYAPNLTSYAIVSLDLGKESCQELLQPDYGEVNVLSFSLGVLKNCLSIIVHYEEGFSDVWLMNDYGKKESWTKFLCLPFLGSPHVFPHGKVICIYGDEVLLQFNSDL |
| ORF Type | 3prime_partial |
| Blastp | F-box protein At3g07870 from Arabidopsis with 36.05% of identity |
|---|---|
| Blastx | F-box protein At3g07870 from Arabidopsis with 36.05% of identity |
| Eggnog | F-box protein(ENOG410YVBU) |
| Kegg | Link to kegg annotations (AT3G07870) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439762.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer