Protein coding transcript 263283

• Transcript: Ll_transcript_113788
• CDS coordinates: 3-572 (+)
• Peptide sequence: VFKRLPPLEKYTIFGFGFDQCSDSYKVVAILCSLSSSDGGSAYVTEVKIHNLGTDSWRRIQEYPFGIPSGLSAKFVSGTLNWLASTHKLSSYAIVSLDLGKESCQELLQPDYGEVNVLSFSLGVLKNCLSIIVHYEEGFSDVWLMNDYGKKESWTKFLCLPFLGSPHVFPHGKVICIYGDEVLLQFNSDL
• ORF Type: internal

Annotations of Ll_transcript_113788

• Blastp: F-box protein At3g07870 from Arabidopsis with 32.3% of identity
• Blastx: F-box protein At3g07870 from Arabidopsis with 32.3% of identity
• Eggnog: F-box protein(ENOG410YVBU)
• Kegg: Link to kegg annotations (AT3G07870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439762.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;