Transcript | Ll_transcript_113829 |
---|---|
CDS coordinates | 1-387 (+) |
Peptide sequence | ICNVQRNMHFNTLNSEPFHSVNSQLRELPAVELSTLPLIIKTVVDSGIADQLRLTELILNDQEFLPKLVEVFRVCEDLENMAGLHMIFEIVKGISQYLCLCYFDLDMHVVIYVCIHSCYIFVLLQFCLI |
ORF Type | internal |
Blastp | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 45.68% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 45.68% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (432127) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462469.1) |
Pfam | Component of IIS longevity pathway SMK-1 (PF04802.14) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer