Protein coding transcript 263417

• Transcript: Ll_transcript_115687
• CDS coordinates: 1-921 (+)
• Peptide sequence: ANSAKTWKEVCFACVDAEEFRFAQICGLNIIVQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRPEKLMEHIKLFATRLNIPKLIRACDEQQHWRELTYLYIQYDEFDNAATTIMNHSPEAWDHMQFKDVIAKVANVELYYKAVHFYLQEHPDLINDVLNVLALRVDHARVVDIMRKAGHLRLVKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDNFDQIGLAQKIEKHELLEMRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGERELAEEL
• ORF Type: internal

Annotations of Ll_transcript_115687

• Blastp: Clathrin heavy chain 2 from Arabidopsis with 93.16% of identity
• Blastx: Clathrin heavy chain 2 from Arabidopsis with 93.16% of identity
• Eggnog: clathrin heavy chain(ENOG410XPH1)
• Kegg: Link to kegg annotations (AT3G08530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416840.1)
• Pfam: Region in Clathrin and VPS (PF00637.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;