Protein coding transcript 263423

• Transcript: Ll_transcript_115707
• CDS coordinates: 204-914 (+)
• Peptide sequence: MPEQVVFWKWISPKILGLVTQTSVYHWSIEGDSEPVKMFDRTANLANNQIINYRCDPTEKWLVLIGIAPGSPERPQLVKGSMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSVLISFASKTLNAGQVISKLHVIELGAQPGKPSFSKKQADLFFPPDFADDFPVAMQISHKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEATSAGGFYAINRRGQVLLATVNEQT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_115707

• Blastp: Clathrin heavy chain 1 from Arabidopsis with 91.14% of identity
• Blastx: Clathrin heavy chain 1 from Arabidopsis with 89.77% of identity
• Eggnog: clathrin heavy chain(ENOG410XPH1)
• Kegg: Link to kegg annotations (AT3G11130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460712.1)
• Pfam: Clathrin propeller repeat (PF01394.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;