Protein coding transcript 263425

• Transcript: Ll_transcript_115697
• CDS coordinates: 1112-1552 (+)
• Peptide sequence: MQLFSVDQQRSQALEAHAAAFAQFKVPGNENPSVLISFATKTVNAGQIISKLHVIEMGAQPGKPSFTKKQADLFFPPDFADDFPVAMQISHKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEATSAGGFYAINRRGQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_115697

• Blastp: Clathrin heavy chain 2 from Arabidopsis with 90.48% of identity
• Blastx: Clathrin heavy chain 2 from Oryza sativa with 86.93% of identity
• Eggnog: clathrin heavy chain(ENOG410XPH1)
• Kegg: Link to kegg annotations (AT3G08530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416840.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;